PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00708.10
Common NameJCGZ_18680, LOC105641664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 246aa    MW: 27070.9 Da    PI: 7.2611
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00708.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.85.2e-334499359
    ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                   k rY+eClkNhA+ +GghavDGCgEfmp+ g+egt +alkCaAC+CHRnFHR+e++e
  Jcr4S00708.10 44 KPRYRECLKNHAVGIGGHAVDGCGEFMPA-GAEGTLDALKCAACNCHRNFHRKETNE 99
                   679*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-222795IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.5E-304697IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.1E-304696IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.4534796IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.7E-32171245IPR009057Homeodomain-like
SuperFamilySSF466894.37E-20171244IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-24183239IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEFEDQEEHD EEEEMDLPAS YDSLGNSTRV KMTSSGAETG HSTKPRYREC LKNHAVGIGG  60
HAVDGCGEFM PAGAEGTLDA LKCAACNCHR NFHRKETNET TNPGGGGGGG GELFFHGHPH  120
PHHLQVPQFT PYYRTPAGYL HVAPPQQRPL ALPSTSGGQS REDQEDVSNP SGGGFGSGGG  180
SSRKRFRTKF TQDQKERMLS LAERLGWRIQ KHDEAVVQQF CNETGVKRHV LKVWMHNNKH  240
TLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-271842411875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081639.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH54e-81ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A067KBY60.0A0A067KBY6_JATCU; Uncharacterized protein
STRINGVIT_00s0199g00250.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]